RAB11A Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RAB11A Antibody
Description:
Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.Specifications:
Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cellsUniProt:
P62491Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WB, IF, FACSPurity:
Antigen affinityFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2% TrehaloseReconstitution:
After reconstitution, the RAB11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This RAB11 antibody is available for research use only.Storage Conditions:
After reconstitution, the RAB11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the RAB11 antibody should be determined by the researcher.CAS Number:
9007-83-4Image Legend:
IF/ICC staining of FFPE human U-2 OS cells with RAB11 antibody (green) at 5ug/ml and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.
