Elongation factor 2 Antibody / EEF2

• Description:

  Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

• Specifications:

  Western blot: 1-2 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P13639

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Monkey

• Immunogen:

  Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, IF, FACS

• Purity:

  Affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Elongation factor 2 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, nuclear

• Image Legend:

  Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.