EEF2 Antibody / Elongation factor 2

• Description :

  Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

• Specifications :

  Western blot: 1-2 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt :

  P13639

• Host :

  Mouse

• Reactivity :

  Human, Mouse, Rat

• Immunogen :

  Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.

• Clonality :

  Monoclonal

• Isotype :

  IgG1

• Clone :

  5F5

• Applications :

  WB, IHC-P, IF, FACS

• Purity :

  Affinity purified

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution :

  After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This EEF2 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the EEF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the EEF2 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Image Legend :

  Immunofluorescent staining of FFPE human HepG2 cells with EEF2 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.