EEF2 Antibody / Elongation factor 2
CAT:
800-RQ6234
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




EEF2 Antibody / Elongation factor 2
- Description: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
- UniProt: P13639
- Host: Mouse
- Immunogen: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.
- Clonality: Monoclonal
- Isotype: IgG1
- Applications: WB, IHC-P, IF, FACS
- Format: Antigen affinity purified
- Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
- Reconstitution: After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
- Limitations: This EEF2 antibody is available for research use only.