SUMO1 Antibody

• Description:

  Small ubiquitin-related modifier 1 (SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

• Specifications:

  Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P63165

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  IHC-P, IF, FACS

• Purity:

  Affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.0125% sodium azide

• Reconstitution:

  After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This SUMO1 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the SUMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the SUMO1 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Predominantly nuclear with some cytoplasmic

• Image Legend:

  IHC staining of FFPE human breast cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.