Properdin Antibody / Complement Factor P / CFP

• Description:

  Properdin (factor P) is a plasma protein that is active in the alternative complement pathway of the innate immune system. It is mapped to Xp11.23. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P27918

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR were used as the immunogen for the Properdin antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, FACS

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the Properdin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Properdin antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the Properdin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the Properdin antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Secreted

• Image Legend:

  Western blot testing of 1) human placenta, 2) human U937, 3) rat brain and 4) mouse brain lysate with Properdin antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.