CD47 Antibody / IAP

• Description :

  CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

• Specifications :

  Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt :

  Q08722

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT were used as the immunogen for the CD47 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB, IHC-P, FACS

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution :

  After reconstitution, the CD47 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This CD47 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the CD47 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the CD47 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Image Legend :

  Flow cytometry testing of fixed human A549 cells with CD47 antibody at 1ug/million cells (blocked with goat sera) ; Red=cells alone, Green=isotype control, Blue= CD47 antibody.