ATF6 Antibody

CAT:
800-R32695
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ATF6 Antibody - image 1

ATF6 Antibody

  • Description :

    ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE) .
  • Specifications :

    Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL
  • UniProt :

    P18850
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the ATF6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This ATF6 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the ATF6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the ATF6 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Image Legend :

    IHC testing of FFPE human breast cancer tissue with ATF6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide