RAB14 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RAB14 Antibody
Description :
Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.Specifications :
Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mLUniProt :
P61106Host :
RabbitReactivity :
Human, Mouse, RatImmunogen :
Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IHC-P, IFPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2% TrehaloseReconstitution :
After reconstitution, the RAB14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This RAB14 antibody is available for research use only.Storage Conditions :
After reconstitution, the RAB14 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the RAB14 antibody should be determined by the researcher.CAS Number :
9007-83-4Image Legend :
Western blot testing of 1) rat brain, 2) human Raji and 3) human SMMC lysate with RAB14 antibody. Expected/observed molecular weight ~24 kDa.
