STAT6 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


STAT6 Antibody
Description :
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X (L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.Specifications :
Western blot: 0.1-0.5 µg/mLUniProt :
P42226Host :
RabbitReactivity :
Human, RatImmunogen :
Amino acids ESIYQRDPLKLVATFRQILQGEKKAVMEQFR of human STAT6 were used as the immunogen for the STAT6 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WBPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the STAT6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This STAT6 antibody is available for research use only.Storage Conditions :
After reconstitution, the STAT6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the STAT6 antibody should be determined by the researcher.CAS Number :
9007-83-4Image Legend :
Western blot testing of rat brain with STAT6 antibody. Predicted/observed molecular weight ~94 kDa.

