STAT2 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


STAT2 Antibody
Description :
Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.Specifications :
Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells, Immunohistochemistry (FFPE) : 2-5 µg/mLUniProt :
P52630Host :
RabbitReactivity :
HumanImmunogen :
Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IF, FACS, IHC-PPurity :
Antigen affinity purifiedFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2% TrehaloseReconstitution :
After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This STAT2 antibody is available for research use only.Storage Conditions :
After reconstitution, the STAT2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the STAT2 antibody should be determined by the researcher.CAS Number :
9007-83-4Location :
Cytoplasm, nucleusImage Legend :
Immunofluorescent staining of FFPE human PC-3 cells with STAT2 antibody (red) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

