STAT2 Antibody

CAT:
800-RQ4293
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
STAT2 Antibody - image 1

STAT2 Antibody

  • Description :

    Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
  • Specifications :

    Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells, Immunohistochemistry (FFPE) : 2-5 µg/mL
  • UniProt :

    P52630
  • Host :

    Rabbit
  • Reactivity :

    Human
  • Immunogen :

    Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IF, FACS, IHC-P
  • Purity :

    Antigen affinity purified
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose
  • Reconstitution :

    After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This STAT2 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the STAT2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the STAT2 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasm, nucleus
  • Image Legend :

    Immunofluorescent staining of FFPE human PC-3 cells with STAT2 antibody (red) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide