STAT2 Antibody
CAT:
800-RQ4293
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
STAT2 Antibody
- Description: Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
- CAS Number: 9007-83-4
- UniProt: P52630
- Host: Rabbit
- Immunogen: Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.
- Clonality: Polyclonal
- Isotype: IgG
- Applications: WB, IF, FACS
- Format: Antigen affinity purified
- Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
- Reconstitution: After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
- Limitations: This STAT2 antibody is available for research use only.