STAT2 Antibody

• Description:

  Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells, Immunohistochemistry (FFPE) : 2-5 µg/mL

• UniProt:

  P52630

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IF, FACS, IHC-P

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This STAT2 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the STAT2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the STAT2 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasm, nucleus

• Image Legend:

  Immunofluorescent staining of FFPE human PC-3 cells with STAT2 antibody (red) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.