IL-10, Rat

CAT:
804-HY-P7098-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-10, Rat - image 1

IL-10, Rat

  • Description :

    IL-10 Protein, Rat is an immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.
  • Product Name Alternative :

    IL-10 Protein, Rat, Rat, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/il-10-protein-rat.html
  • Purity :

    95.0
  • Smiles :

    SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
  • Molecular Formula :

    25325 (Gene_ID) P29456 (S19-N178) (Accession)
  • Molecular Weight :

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Ball C, et al. Rat interleukin-10: production and characterisation of biologically active protein in a recombinantbacterial expression system. Eur Cytokine Netw. 2001 Mar;12 (1) :187-93.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide