IL-10, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IL-10, Human
Description :
IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.Product Name Alternative :
IL-10 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/il-10-protein-human.htmlPurity :
97.60Smiles :
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNMolecular Formula :
3586 (Gene_ID) P22301/NP_000563.1 (S19-N178) (Accession)Molecular Weight :
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

