Goat anti-GFP Polyclonal antibody

CAT:
894-AB66800-100
Size:
250 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-GFP Polyclonal antibody - image 1

Goat anti-GFP Polyclonal antibody

  • Description:

    Goat polyclonal antibody to GFP (green fluorescent protein) conjugated to DyLight® 800. GFP is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to blue light. In cell and molecular biology, the GFP protein is frequently used as a reporter of expression.
  • Specifications:

    In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize mCherry fluorescent protein.
  • Product Name Alternative:

    Green fluorescent protein antibody.
  • UNSPSC Description:

    Green Fluorescent Protein
  • Volume:

    100 µL
  • Host:

    Goat
  • Reactivity:

    Green Fluorescent Protein.
  • Immunogen:

    Purified recombinant peptide produced in E. coli.
  • Target Antigen:

    Purified recombinant peptide produced in E. coli.
  • Immunogen Type:

    Recombinant protein
  • Target:

    Anti-GFP, DyLight®800
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Conjugation:

    DyLight®800
  • Type:

    Primary
  • Sequence:

    MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
  • Applications:

    WB, IF, IHC-F
  • Purification:

    Epitope affinity purified
  • Concentration:

    2.5 mg/mL
  • Dilution:

    WB:1:500-1:5,000, IF:1:50-1:1,000, IHC-F:1:50-1:1,000
  • Form:

    Polyclonal antibody supplied as a 100 µl (2.5 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
  • Buffer:

    PBS, 20% glycerol and 0.05% sodium azide
  • Storage Conditions:

    For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
  • CAS Number:

    9007-83-4