Goat anti-GFP Polyclonal antibody

CAT:
894-AB0066-500
Size:
1.5 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-GFP Polyclonal antibody - image 1

Goat anti-GFP Polyclonal antibody

  • Description:

    Goat polyclonal antibody to GFP (green fluorescent protein). GFP is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to blue light. In cell and molecular biology, the GFP protein is frequently used as a reporter of expression.
  • Specifications:

    In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize mCherry fluorescent protein.
  • Product Name Alternative:

    Green fluorescent protein antibody.
  • UNSPSC Description:

    Green Fluorescent Protein
  • Volume:

    500 µL
  • Host:

    Goat
  • Reactivity:

    GFP
  • Immunogen:

    Purified recombinant peptide produced in E. coli.
  • Target Antigen:

    Purified recombinant peptide produced in E. coli.
  • Immunogen Type:

    Recombinant protein
  • Target:

    anti-GFP
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Conjugation:

    Unconjugated
  • Type:

    Primary
  • Sequence:

    MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
  • Applications:

    WB, IF, IHC-P, IHC-F
  • Purification:

    Epitope affinity purified
  • Concentration:

    3 mg/mL
  • Dilution:

    WB:1:500-1:5,000, IF:1:50-1:1,000, IHC-P:1:50-1:1,000, IHC-F:1:50-1:1,000, IEM:1:50-1:1,000
  • Buffer:

    PBS, 20% glycerol and 0.05% sodium azide
  • References & Citations:

    1. Serifi I, Besta S, Karetsou Z, et al. Sci Rep 2021 Jul. PMID: 34230583 2. Castellanos-Jankiewicz A, Guzmán-Quevedo O, Fénelon VS, et al. Cell Metab 2021 Apr. PMID: 33887197 3. Fan L, Froehlich K, Melzer E, et al. bioRxiv, 2021 4. Yu Z, McIntosh JM, Sadeghi SG, et al. J Neurophysiol 2020 Aug. PMID: 32609559 5. Al-Saad RZ, Kerr I, Hume AN. ASSAY and Drug Development Technologies 2020 May. PMID: 32384245 6. Schlöffel MA, Salzer A, Wan WL, et al. Plant Physiol 2020 May. PMID: 32152212 7. Schlöffel M, Salzer A, Wan W, et al. bioRxiv 2020 8. Fröhlich K. PhD Thesis, University of Tübingen, Germany, 2020 9. Schlöffel MA, PhD Thesis, University of Tübingen, Germany, 2019 10. Zhang Y, Tang N, Luo J, et al. J Virol 2019 Aug. PMID:31189706 11. Meyers A, Furtmann C, Gesing K, et al. Microb Biotechnol 2019 Jun.PMID:31237428 12. Anjo SI, Melo MN, Loureiro LR, et al. Redox Biol 2019 Apr. PMID:30737169 13. Vicente MM, Mendes A, Cruz M, et al. bioRxiv 2019 14. Gassama A, PhD Thesis, Zurich University, Swizterland, 2018 15. Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018 16. Almeida F, Luís MP, Pereira IS, et al. Front Cell Infect Microbiol 2018 Jul. PMID:30094225 17. Radtke C and Tews BA. J Gen Virol 2017 Oct. PMID:28874234 18. Wei-Lin Wan, PhD Thesis, University of Tubingen, Germany, 2017 19. Tiede C, Bedford R, Heseltine SJ, et al. Elife 2017 Jun. PMID:28654419 20. Gabriel SS, Belge H, Gassama A, et al. Kidney Int 2017 Apr. PMID:28143656 21. Krishnamurthy VV, Khamo JS, Mei W, et al. Development 2016 Nov. PMID:27697903 22. Zhang-Hooks Y, Agarwal A, Mishina M, et al. Neuron 2016 Jan (Supplemental Information). PMID:26774161 23. Carneiro L, Geller S, Fioramonti X, et al. Am J Physiol Endocrinol Metab 2016 Jan. PMID:26530151 24. Roux I, Wu JS, McIntosh JM, et al. J Neurophysiol 2016 Apr. PMID: 27098031 25. Bugalhão JN, Mota LJ, Franco IS. Microbiologyopen 2015 Dec. PMID:26626407 26. Sargiannidou I, Kim GH, Kyriakoudi S, et al. Neurogenetics 2015 Mar. PMID: 25771809 27. Issa JB, Haeffele BD, Agarwal A, et al. Neuron 2014 Aug (Supplemental Information). PMID:25088366 28. Moreiras HAF, MSc Thesis, University of Lisbon, Portugal, 2014
  • Storage Conditions:

    For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
  • CAS Number:

    9007-83-4