Goat anti-GFP Polyclonal antibody

• Description:

  Goat polyclonal antibody to GFP (green fluorescent protein). GFP is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to blue light. In cell and molecular biology, the GFP protein is frequently used as a reporter of expression.

• Specifications:

  In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does recognize YFP and CFP and does not recognize RFP and mCherry fluorescent proteins.

• Product Name Alternative:

  Green fluorescent protein antibody.

• UNSPSC Description:

  Green Fluorescent Protein

• Volume:

  200 µL

• Host:

  Goat

• Reactivity:

  GFP

• Immunogen:

  Purified recombinant peptide produced in E. coli.

• Target Antigen:

  Purified recombinant peptide produced in E. coli.

• Immunogen Type:

  Recombinant protein

• Target:

  anti-GFP

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Conjugation:

  Unconjugated

• Type:

  Primary

• Sequence:

  MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

• Applications:

  WB, IF, IHC-P, IHC-F

• Purification:

  Epitope affinity purified

• Concentration:

  2 mg/mL

• Dilution:

  WB:1:500-1:5,000, IF:1:50-1:1,000, IHC-P:1:50-1:1,000, IHC-F:1:50-1:1,000, IEM:1:50-1:1,000

• Form:

  Polyclonal antibody supplied as a 200 or 500 µl (2 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

• Buffer:

  PBS, 20% glycerol and 0.05% sodium azide

• References & Citations:

  1. Cabaço LC, Bento-Lopes L, Neto MV, et al. JID Innov 2022 Jun. PMID: 36090299 2. Yilmaz V, Louca P, Potamiti L, et al. Elife 2022 May. PMID: 35533001 3. Martins-Marques T, Costa MC, Catarino S, et al. EMBO Rep 2022 May. PMID: 35593040 4. Ferreira JV, Soares AR, Ramalho J, et al. Sci Adv 2022 Mar. PMID: 35333565 5. Wang WA , Demaurex N, et al. J Biol Chem 2022 Mar. PMID: 35065962 6. Escrevente C, Bento-Lopes L, Ramalho JS, et al. J Cell Sci 2021 May. PMID: 34002205 7. Annibaldis G, Domanski M, Dreos R, et al. Nucleic Acids Res 2020 Sep. PMID: 32941650 8. Shoaito H, Chauveau S, Gosseaume C, et al. J Cell Mol Med 2020 Jun. PMID: 32519441 9. Panayiotou T, Michael S, Zaravinos A, et al. PLOS Pathog Apr 2020. PMID:32298395 10. Wu JS, Yi E, Manca M, et al. Elife 2020 Jan. PMID:31975688 11. Alvarez C, Campos AC, Howard JC, et al. Methods Mol Biol 2020. PMID: 31758463 12. Carey LM, PhD Thesis, Indiana University, US 2019 13. Zhang L, Noguchi YT, Nakayama H, et al. Cell Rep 2019 Nov. PMID: 31747590 14. Fukuda S, Kaneshige A, Kaji T, et al. Elife 2019 Sep. PMID:31545169 15. Matsuda T, Oinuma I. Sci Rep 2019 Aug. PMID:31383899 16. Geller S, Arribat Y, Netzahualcoyotzi C, et al. Cell Metab 2019 Aug. PMID:31474567 17. Zhang L, Uezumi A, Kaji T, et al. Int J Mol Sci 2019 Jul. PMID:31277245 18. Alenquer M, Vale-Costa S, Etibor TA, et al. Nat Commun 2019 Apr. PMID:30967547 19. Koike M, Yutoku Y, Koike A. FEBS Open Bio 2019 Jan. PMID:31115163 20. Vyas P, Wu JS, Jimenez A, et al. Sci Rep 2019 Apr. PMID:30944354 21. Alenquer M, Vale-Costa S, Sousa AL, et al. bioRxiv 410373; Sept 2018 22. Larson VA, Mironova Y, Vanderpool KG, et al. Elife 2018 Mar. PMID:29596047 23. Festa BP, Chen Z, Berquez M, et al. Nat Commun 2018 Jan. PMID:29323117 24. Ramos-Nascimento A, Kellen B, Ferreira F, et al. J Cell Sci 2017 Dec. PMID:29061883 25. Wu JS, Vyas P, Glowatzki E, et al. J Comp Neurol 2017 Oct. PMID:29055051 26. Agarwal A, Wu PH, Hughes EG, et al. Neuron 2017. PMID:28132831 27. Mimura Y, Takagi M, Clever M, et al. J Cell Sci 2016 Nov. PMID:27802161 28. Vyas P, Wu JS, Zimmerman A, et al. J Assoc Res Otolaryngol 2016 Sep. PMID:27696081 29. Vale-Costa S, Alenquer M, Sousa AL, et al. J Cell Sci 2016 Mar. PMID:26940915 30. Martins-Marques T, Anjo SI, Pereira P, et al. Mol Cell Proteomic 2015 Aug. PMID:26316108 Supplemental Information 31. Sargiannidou I, Kim GH, Kyriakoudi S, et al. Neurogenetics 2015 Jul. PMID: 25771809 32. Kourti M, Ikonomou G, Giakoumakis NN, et al. Cell Signal 2015 Mar. PMID: 25744540 33. Monteiro NCO, MSc Thesis, University of Coimbra, Portugal 2015 34. Ferreira RRS, MSc Thesis, University of Coimbra, Portugal 2015 35. Paukert M, Agarwal A, Cha J, et al. Neuron 2014 Jun. PMID: 24945771 Supplemental Information 36. Moreiras HAF, MSc Thesis, University of Lisbon, Portugal, 2014 37. Pais SV, Milho C, Almeida F, et al. PLoS One 2013. PMID: 23431368

• Storage Conditions:

  For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.

• CAS Number:

  9007-83-4