Products for Research Use Only
RegisterLogin

PDCD10, Human

CAT: 0804-HY-P71190Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71190Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.
Product Name Alternative
PDCD10 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdcd10-protein-human.html
Smiles
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Molecular Formula
11235 (Gene_ID) Q9BUL8 (M1-Al212) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS19799Pdcd10 Mouse Pre-designed siRNA Set A
HY-RS26295Pdcd10 Rat Pre-designed siRNA Set A
HY-P71191-01PDCD4, Human (His)
HY-P71019-01PDCD5, Human (His)
HY-RS10189PDCD11 Human Pre-designed siRNA Set A
HY-RS10185PDCD1 Human Pre-designed siRNA Set A
HY-P7856-01PDCD8/AIFM1, Human (His)
HY-RS10191PDCD2 Human Pre-designed siRNA Set A
HY-RS10193PDCD5 Human Pre-designed siRNA Set A
HY-RS10194PDCD6 Human Pre-designed siRNA Set A

Alternative Products

CatalogName
MBS7611244-01Recombinant Human PDCD10
36258051PDCD10 Adenovirus (Human)
GTR18880646-01Human PDCD10 protein
MBS8230531-01PDCD10 siRNA (Human)
abx903883-01Human PDCD10 siRNA
EF001627Human PDCD10 ELISA KIT
CF25-1mgRecombinant Human PDCD10/TFAR15
GTR19124506-01Recombinant Human PDCD10 Protein
RP022828PDCD10 Recombinant Protein (Human)
TMPJ-01300-01PDCD10 Protein, Human, Recombinant

Popular Products