PDCD10, Human

• Description :

  The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  PDCD10 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pdcd10-protein-human.html

• Smiles :

  MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

• Molecular Formula :

  11235 (Gene_ID) Q9BUL8 (M1-Al212) (Accession)

• Molecular Weight :

  Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins