CTCF, Human

• Description :

  CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  CTCF Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ctcf-protein-human.html

• Purity :

  95.00

• Smiles :

  MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

• Molecular Formula :

  10664 (Gene_ID) P49711-1 (M1-I154) (Accession)

• Molecular Weight :

  Approximately 38 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins