Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)

Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)

• CAS Number: 9000-83-3
• Gene Name: CLDN6
• UniProt: P56747
• Expression Region: 2-220aa
• Organism: Homo sapiens
• Target Sequence: ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
• Tag: Email us to check on the available tags
• Source: Mammalian cell
• Field of Research: Cancer
• Assay Type: MP-Detergent Transmembrane Protein & Active Protein & In Stock Protein
• Relevance: Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 0.6949-1.158 ng/mL.
• Length: Partial
• Form: Liquid
• Buffer: 50 mM HEPES，0.15 M NaCl， 0.05% DDM，0.01% CHS，pH7.5
• Molecular Weight: 27.7 kDa
• References & Citations: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003) "Complete sequencing and characterization of 21, 243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.