Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)
CAT:
399-CSB-MP005508HU(A5)-D-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
-D-AC1.jpg)
-D-SDS.jpg)

-D-AC1.jpg&w=128&q=75)
-D-SDS.jpg&w=128&q=75)

Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)
- CAS Number: 9000-83-3
- Gene Name: CLDN6
- UniProt: P56747
- Expression Region: 2-220aa
- Organism: Homo sapiens
- Target Sequence: ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
- Tag: Email us to check on the available tags
- Source: Mammalian cell
- Field of Research: Cancer
- Assay Type: MP-Detergent Transmembrane Protein & Active Protein & In Stock Protein
- Relevance: Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 0.6949-1.158 ng/mL.
- Length: Partial
- Form: Liquid
- Buffer: 50 mM HEPES,0.15 M NaCl, 0.05% DDM,0.01% CHS,pH7.5
- Molecular Weight: 27.7 kDa
- References & Citations: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003) "Complete sequencing and characterization of 21, 243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.