Recombinant Human Claudin-6 (CLDN6) -VLPs (Active)
CAT:
399-CSB-MP005508HU(A4)-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
-AC1.jpg)
-WB.jpg)
-TEM1.jpg)

-AC1.jpg&w=128&q=75)
-WB.jpg&w=128&q=75)
-TEM1.jpg&w=128&q=75)

Recombinant Human Claudin-6 (CLDN6) -VLPs (Active)
- CAS Number: 9000-83-3
- Gene Name: CLDN6
- UniProt: P56747
- Expression Region: 1-220aa
- Organism: Homo sapiens
- Target Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
- Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
- Source: Mammalian cell
- Field of Research: Cancer
- Assay Type: MP-VLP Transmembrane Protein & Active Protein & In Stock Protein
- Relevance: "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102 (2010)
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: The purity information is not available for VLPs proteins.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 1.501-2.035 ng/mL
- Length: Full Length
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
- Molecular Weight: 25.1 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.