Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488
CAT:
400-SPR-518C-A488
Size:
2x 100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488
Background:
The alpha-synuclein (aSyn) E114C mutation facilitates a single site-specific conjugation with ATTO-488 maleimide that avoids any hindrance on fibrilization or cell entry that may be conferred by non-specific lysine targeting conjugations. This conjugation is ideal due to internal position relative to C-terminal truncation sites, proximity to the NAC, and lack of interference with recruitment in vitro or in primary neurons (1, 2). Pre-formed fibrils (PFFs) generated with 5-25% fluorescently tagged E114C mutants have demonstrated a relative potency >80% compared to wild-type aSyn for inducing misfolding of endogenous aSyn, indicating no significant perturbation of seeding in living cells (1). Atto-488 is a useful tool for identifying cell entry, as the addition of Trypan Blue to cultures prior to imaging will quench fluorescence of extracellular Atto-488 conjugated aSyn (3). Our aSyn E114C-Atto-488 PFFs, which are formed from 10% fluorescently tagged E114C mutants and 90% wild-type monomers, are an excellent tool for studying cell entry and localization, with demonstrated entry into neurons after trypan blue quenching.Description:
Human Recombinant Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488Product Name Alternative:
Alpha synuclein pre-formed fibril, Alpha-synuclein PFF, Alpha synuclein protein fibrils, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 ProteinUNSPSC:
12352202Swiss Prot:
P37840Host:
E.coliOrigin Species:
HumanTarget:
Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488Conjugation:
ATTO 488Sequence:
10% of mixture (mutant conjugated form): MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMPVDPDNEAYEMPSEEGYQDYEPEA 90% of mixture (wildtype): MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAApplications:
WB, Native PAGE, In vitro Assay, In vivo AssayPurification Method:
Ion-exchange & SEC purifiedConcentration:
Lot/batch specific. See included datasheet.Purity:
>95%Weight:
0.02Length:
140 aaBuffer:
1X PBS pH 7.4Molecular Weight:
14.434 kDaPrecautions:
Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.Additionnal Information:
For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information.References & Citations:
1. Haney et al. 2016. Comparison of strategies for non-perturbing labeling of α-synuclein to study amyloidogenesis. Organic & Biomolecular Chemistry. DOI: 10.1039/c5ob02329g 2. Karpowicz et al. 2017. Selective imaging of internalized proteopathic a-synuclein seeds in primary neurons reveals mechanistic insight into transmission of synucleinopathies. JBC. DOI: 10.1074/jbc.M117.780296 3. Pieri et al. 2016. Structural and functional properties of prefibrillar α-synuclein oligomers. Scientific Reports. DOI: 10.1038/srep24526
MSDS Document
View Document