Alpha Synuclein E114C Mutant Monomers: ATTO 488

CAT:
400-SPR-517E-A488
Size:
5x 100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein E114C Mutant Monomers: ATTO 488 - image 1

Alpha Synuclein E114C Mutant Monomers: ATTO 488

  • Background:

    The alpha-synuclein (aSyn) E114C mutation facilitates a single site-specific conjugation with ATTO-488 maleimide that avoids any hindrance on fibrilization or cell entry that may be conferred by non-specific lysine targeting conjugations. This conjugation is ideal due to internal position relative to C-terminal truncation sites, proximity to the NAC, and lack of interference with recruitment in vitro or in primary neurons (1, 2). Pre-formed fibrils (PFFs) generated with 5-25% fluorescently tagged E114C mutants have demonstrated a relative potency >80% compared to wild-type aSyn for inducing misfolding of endogenous aSyn, indicating no significant perturbation of seeding in living cells (1). Atto-488 is a useful tool for identifying cell entry, as the addition of Trypan Blue to cultures prior to imaging will quench fluorescence of extracellular Atto-488 conjugated aSyn (3). Our aSyn E114C-Atto-488 PFFs, which contain 10% fluorescently tagged E114C mutants, are an excellent tool for studying cell entry and localization, with demonstrated entry into neurons after trypan blue quenching.
  • Description:

    Human Recombinant Alpha Synuclein E114C Mutant Monomers: ATTO 488
  • Product Name Alternative:

    Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkinson's disease familial 1 Protein
  • UNSPSC:

    12352202
  • Swiss Prot:

    P37840
  • Host:

    E.coli
  • Origin Species:

    Human
  • Target:

    Alpha Synuclein E114C Mutant Monomers: ATTO 488
  • Conjugation:

    ATTO 488
  • Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Applications:

    WB, Native PAGE, In vitro Assay, In vivo Assay
  • Purification Method:

    Ion-exchange & SEC purified
  • Concentration:

    Lot/batch specific. See included datasheet.
  • Purity:

    >95%
  • Weight:

    0.05
  • Length:

    140 aa
  • Buffer:

    1X PBS pH 7.4
  • Molecular Weight:

    14.434 kDa
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information:

    For corresponding PFFs, see catalog# SPR-518-A488
  • References & Citations:

    1. Haney et al. 2016. Comparison of strategies for non-perturbing labeling of α-synuclein to study amyloidogenesis. Organic & Biomolecular Chemistry. DOI: 10.1039/c5ob02329g 2. Karpowicz et al. 2017. Selective imaging of internalized proteopathic a-synuclein seeds in primary neurons reveals mechanistic insight into transmission of synucleinopathies. JBC. DOI: 10.1074/jbc.M117.780296 3. Pieri et al. 2016. Structural and functional properties of prefibrillar α-synuclein oligomers. Scientific Reports. DOI: 10.1038/srep24526

MSDS

MSDS Document

View Document