MIF, Human (His, solution)

• Description:

  The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative:

  MIF Protein, Human (His, solution), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/mif-protein-human-his.html

• Purity:

  99.60

• Smiles:

  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

• Molecular Formula:

  4282 (Gene_ID) P14174 (M1-A115) (Accession)

• Molecular Weight:

  Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Dry ice.

• Storage Conditions:

  Stored at -80°C for 1 year

• Scientific Category:

  Recombinant Proteins