COMT, Human (His)

• Description:

  Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (His) is the recombinant human-derived COMT protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative:

  COMT Protein, Human (His), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/comt-protein-human-his.html

• Purity:

  93.00

• Smiles:

  GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

• Molecular Formula:

  1312 (Gene_ID) P21964 (G52-P271) (Accession)

• Molecular Weight:

  25-28 kDa

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins