Products for Research Use Only
RegisterLogin

CD252 Recombinant Protein

CAT: 0384-NCP0403-01Size: 500 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-NCP0403-01Size:500 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
OX40 (TNFRSF4, CD134) is a member of the tumor necrosis factor (TNF) receptor superfamily that regulates T cell activity and immune responses. The OX40 protein contains four cysteine rich domains, a transmembrane domain, and a cytoplasmic tail containing a QEE motif. OX40 is primarily expressed on activated CD4+ and CD8+ T-cells, while the OX40 ligand (OX40L, TNFSF4, CD252) is predominantly expressed on activated antigen presenting cells. The engagement of OX40 with OX40L leads to the recruitment of TNF receptor-associated factors (TRAFs) and results in the formation of a TCR-independent signaling complex. One component of this complex, PKCθ, activates the NF-κB pathway. OX40 signaling through Akt can also enhance TCR signaling directly. Research studies indicate that the OX40L-OX40 pathway is associated with inflammation and autoimmune diseases. Additional research studies show that OX40 agonists augment anti-tumor immunity in several cancer types.
CAS Number
9000-83-3
Swiss Prot
P23510
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~15kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Related Products

CatalogName
MB66937-01CD252 monoclonal antibody
NCP0380-01CD212 Recombinant Protein
NCP0375-01CD282 Recombinant Protein
NCP0195-01CD262 Recombinant Protein
NCP0354-01CD232 Recombinant Protein
NCP0400-01CD258 Recombinant Protein
NCP0194-01CD253 Recombinant Protein
NCP0343-01CD242 Recombinant Protein
NCP0191-01CD22 Recombinant Protein
NBP0425Recombinant Protein A Protein

Alternative Products

CatalogName
GTR18991758-01CD252 Recombinant Protein
PX-P6998-01Dog CD252 recombinant protein
CRP2894-01Recombinant Mouse CD252 Protein
TD-ATMP00417HURecombinant Human CD252 protein
TP727854CD252 (TNFSF4) Human Recombinant Protein
PPT-11364Human CD252/TNFSF4 Recombinant Protein
PX-P5595-100CD252 / TNFSF4, N-His, recombinant protein
E45H33859M5CD252 (TNFSF4) (NM_003326) Human Recombinant Protein
7059006OX40L (CD134L, CD252) Recombinant Protein, Human
PPT-11366Human CD252/TNFSF4/OX40L Recombinant Protein

Popular Products