Products for Research Use Only
RegisterLogin

CD368 Recombinant Protein

CAT: 0384-NCP0401-01Size: 500 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-NCP0401-01Size:500 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs include alpha-mannans on C.albicans hypheas and mycobacterial trehalose 6,6'-dimycolate (TDM) . Interacts with signaling adapter Fc receptor gamma chain/FCER1G, likely via CLEC4E, to form a functional complex in myeloid cells. Binding of mycobacterial TDM or C.albicans alpha-mannans to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. The heterodimer formed with CLEC6A is active against fungal infection. Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T-cells.
CAS Number
9000-83-3
Swiss Prot
Q8WXI8
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~19kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Related Products

CatalogName
NCP0362-01CD367 Recombinant Protein
NCP0320-01CD369 Recombinant Protein
NCP0307-01CD358 Recombinant Protein
NCP0310-01CD362 Recombinant Protein
NCP0298-01CD338 Recombinant Protein
NCP0413-01CD366 Recombinant Protein
NCP0329-01CD365 Recombinant Protein
NCP0315-01CD369 Recombinant Protein
NCP0311-01CD364 Recombinant Protein
NCP0308-01CD360 Recombinant Protein

Alternative Products

CatalogName
E43CP0401CD368 Recombinant Protein
MBS1587598-01Recombinant Human CD368/CLEC4D Protein, N-His
ARO-P20906-01Human CD368/CLEC4D Recombinant Protein, C-His
PR15481Recombinant Human CD368/CLEC4D Protein, N-Fc
HV778011-01Human CD368/CLEC4D Recombinant Protein (C-His)
PR15480Recombinant Human CD368/CLEC4D Protein, C-His
HV778021-01Human CD368/CLEC4D Recombinant Protein (N-Fc)
P502065CD368/CLEC4D Protein (N-His, Human)
NBP2-34965Recombinant Protein A Protein
552756CD368

Popular Products