CD23A Recombinant Protein

CAT: 0384-NCP0350-01Size: 500 µgDry Ice: NoHazardous: No
CAT#:0384-NCP0350-01Size:500 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Background
The human leukocyte differentiation antigen CD23 (FCE2) is a type II integral membrane glycoprotein that is expressed on mature B cells, monocytes, eosinophils, platelets and dendritic cells. In mouse, CD23 is found only on mature B cells. CD23 is a low affinity IgE receptor that mediates IgE-dependent cytotoxicity and phagocytosis by macrophages and eosinophils. CD23 associates as an oligomer where cooperative binding of at least two lectin domains is required for high affinity IgE binding to CD23. It may play a role in antigen presentation by B cells by interacting with CD40. CD23 has been shown to be associated with the Fyn tyrosine kinase. The truncated molecule can be secreted, then function as a potent mitogenic growth factor. ADAM8, ADAM15 and MDC-L catalyze ectodomain shedding of CD23. Intestinal cells coexpress CD23a and CD23b, and the two splice forms show different localizations in polarized cells.
CAS Number
9000-83-3
Swiss Prot
P06734
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~35kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
MDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Related Products

CatalogName
NCP0354-01CD232 Recombinant Protein
NCP0345-01CD230 Recombinant Protein
NCP0398-01CD238 Recombinant Protein
NCP0368-01CD235a Recombinant Protein
NBP0425Recombinant Protein A Protein
BS47645CD23 Recombinant Rabbit mAb
NCP0391-01Protein-G Recombinant Protein
NBP0426Recombinant Protein G Protein
BS45886-01CD239/BCAM Recombinant Rabbit mAb
NCP0357-01CD90 Recombinant Protein

Alternative Products

CatalogName
E43CP0350CD23A Recombinant Protein
396865-01FCER2, Recombinant, Human, aa48-321, His-Tag (Low Affinity Immunoglobulin Epsilon Fc Receptor Isoform A, BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF)
NBP2-34965Recombinant Protein A Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
PROTB3GGB2-20ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
P4242-10mgRecombinant Protein A
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
22060644-1Protein A (Recombinant)

Popular Products