Products for Research Use Only

CD267 Recombinant Protein

CAT: 0384-NCP0339-01Size: 500 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-NCP0339-01Size:500 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
Transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI), also known as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) and cluster of differentiation 267 (CD267), is a single-pass type III membrane receptor that is highly expressed on the surface of mature innate-like B cells, such as marginal zone and B-1 B cells in mice, and memory B cells in humans. TACI/TNFRSF13B/CD267 is also expressed on the surface of activated T cells, while monocytes and dendritic cells express lower levels of TACI/TNFRSF13B/CD267 primarily intracellularly. TACI/TNFRSF13B/CD267 is the receptor for soluble ligands BAFF/TNFSF13B and APRIL/TNFSF13. Upon ligation, TACI/TNFRSF13B/CD267 recruits tumor necrosis factor receptor–associated factor (TRAF) family members and calcium signal-modulating cyclophilin ligand (CAMLG) in order to activate NFAT, NF-κB, and AP-1 transcriptional programs. TACI/TNFRSF13B/CD267 is necessary for T cell-independent type II and type I responses, negative regulation of B cell and T follicular helper cell numbers, and promotion of class switch recombination in B cells. Mutations and aberrant regulation of TACI/TNFRSF13B/CD267 has been associated with cancer, autoimmune diseases, and immunodeficiency disorders. Multiple isoforms produced by alternative splicing have been identified.
CAS Number
9000-83-3
Swiss Prot
O14836
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~22kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS