Alpha Synuclein S129A Mutant Monomers

CAT:
400-SPR-505B
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein S129A Mutant Monomers - image 1
Alpha Synuclein S129A Mutant Monomers - image 2
Alpha Synuclein S129A Mutant Monomers - image 3
Thumbnail 1
Thumbnail 2
Thumbnail 3

Alpha Synuclein S129A Mutant Monomers

  • Background:

    Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson’s disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]). Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2). Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.
  • Description:

    Human Recombinant Alpha Synuclein S129A Mutant Monomers
  • Product Name Alternative:

    Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
  • UNSPSC:

    12352202
  • Swiss Prot:

    P37840-1
  • Host:

    E. coli
  • Origin Species:

    Human
  • Target:

    Alpha Synuclein S129A
  • Conjugation:

    No Tag
  • Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
  • Applications:

    WB, In vivo Assay, In vitro Assay
  • Purification Method:

    Ion-exchange Purified
  • Concentration:

    2 mg/ml
  • Purity:

    >95%
  • Weight:

    0.01
  • Length:

    Full length (1 - 140 aa)
  • Buffer:

    1X PBS pH7.4
  • Molecular Weight:

    14.44 kDa
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information:

    For corresponding PFFs, see catalog# SPR-506
  • References & Citations:

    1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.13234 2. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.

MSDS

MSDS Document

View Document