Alpha Synuclein S129A Mutant Pre-formed Fibrils

CAT:
400-SPR-506B
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein S129A Mutant Pre-formed Fibrils - image 1

Alpha Synuclein S129A Mutant Pre-formed Fibrils

  • Background:

    Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson’s disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]) . Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2) . Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.
  • Description:

    Human Recombinant Alpha Synuclein S129A Mutant PFFs
  • Product Name Alternative:

    Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
  • UNSPSC:

    12352202
  • UN Code:

    Non-hazardous
  • Hazard Statement:

    Non-hazardous
  • Swiss Prot:

    P37840-1
  • Expression System:

    E. coli
  • Host:

    E. coli
  • Origin Species:

    Human
  • Target:

    Alpha Synuclein S129A
  • Conjugation:

    No Tag
  • Nature:

    Recombinant
  • Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
  • Applications:

    WB | In vivo Assay | In vitro Assay
  • Field of Research:

    Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
  • Purification Method:

    Ion-exchange Purified
  • Purification:

    Ion-exchange Purified
  • Limit Of Detection:

    Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
  • Concentration:

    2 mg/ml
  • Purity:

    >95%
  • Weight:

    0.01
  • Length:

    Full length (1 - 140 aa)
  • Buffer:

    1X PBS pH7.4
  • Molecular Weight:

    14.44 kDa
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information:

    For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-505.
  • References & Citations:

    1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.13234 2. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.
  • Shipping Conditions:

    Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
  • Storage Conditions:

    -80ºC
  • Notes:

    For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-505.
  • Protein Length:

    Full length (1 - 140 aa)
  • Background Reference 01:

    1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.13234 2. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.
  • AA Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
  • Immunogen Species:

    Human

MSDS

MSDS Document

View Document