Products for Research Use Only
RegisterLogin

RecombinantPF-4/CXCL4, Human

CAT: 0384-BK0328-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0328-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the α-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 10 ug/ml, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
~7.8 kDa, observed by non-reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Related Products

CatalogName
PR1109-01Recombinant Human Platelet Factor-4/CXCL4 (rHuPF-4/CXCL4)
CEK1879Human CXCL4 ELISA Kit
BS77247-01CXCL4/PF4 polyclonal antibody
BK0245-01RecombinantIL-4, Human
BK0144-01RecombinantNT-4, Human
BK0042-01RecombinantFGF-4, Human
PR1072-01Recombinant Human Interleukin-4 (rHuIL-4)
PR1117-01Recombinant Human Syndecan-4 (rHuSDC-4)
PR1102-01Recombinant Human Neurotrophin-4 (rHuNT-4)
PR1098-01Recombinant Human MIP-4 (rHuMIP-4/CCL18)

Alternative Products

CatalogName
GTR18990215-01RecombinantPF-4/CXCL4, Human
BK0328RecombinantPF-4/CXCL4,Human
JOT-PR1109Recombinant Human Platelet Factor-4/CXCL4 (rHuPF-4/CXCL4)
HY-P76853A-01PF-4/CXCL4, Human
MBS692010-01Human PF-4 (CXCL4)
RC312-15PF-4, CXCL4, human
HY-P76853-01PF-4/CXCL4, Human (solution)
PT_72749-01Platelet Factor-4 Human (CXCL4)
rAP-0247Platelet Factor-4 Human (CXCL4)
7-02068Human Platelet Factor-4 (CXCL4)

Popular Products