Products for Research Use Only

RecombinantPDGF-CC, Human

CAT: 0384-BK0327-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0327-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB) .
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
15~19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG