Products for Research Use Only

RecombinantOSM, Mouse (HEK293-expressed)

CAT: 0384-BK0326-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0326-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
10-40 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR