RecombinantOTOR, Human

• Description:

  OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3) -like domain. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46-107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes part in the initiation of periotic mesenchyme chondrogenesis. Recombinant human Otoraplin (OTOR) produced in CHO cells is a single non-glycosylated polypeptide chain containing 111 amino acids. A fully biologically active molecule, rhOTOR has a molecular mass of 14-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

• Endotoxin:

  < 0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE.

• Bioactivity:

  Data Not Available.

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  14-15 kDa, observed by reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant human Otoraplin (OTOR) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Otoraplin (OTOR) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  CHO

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENG AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE