RecombinantNOV, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantNOV, Human
Description :
Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.Endotoxin :
< 0.2 EU/μg, determined by LAL method.Purity :
> 95% as analyzed by SDS-PAGE and HPLC.Bioactivity :
ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight :
20-50 kDa, observed by reducing SDS-PAGE.Storage Conditions :
Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation :
Lyophilized after extensive dialysis against PBS.Host or Source :
CHORecommended Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number :
9000-83-3AA Sequence :
TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK TTRGKM

