Products for Research Use Only

RecombinantHB-EGF, Human

CAT: 0384-BK0218-02Size: 25 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0218-02Size:25 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 <0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
12-14 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL

Popular Products