RecombinantHB-EGF, Human

CAT: 0384-BK0218-01Size: 5 μgDry Ice: NoHazardous: No

CAT#:0384-BK0218-01Size:5 μg

Selected

PRICE

AVAILABILITY: InStock

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

1 / 1

Description

Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 <0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

12-14 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL

Related Products

Catalog	Name
CEK1756	Human EGF ELISA Kit
PPL00040-1a	PET30-Egf
BS49122-01	EGF Recombinant Rabbit mAb
BS48138-01	EGF Recombinant Rabbit mAb
BS45625-01	EGF Recombinant Rabbit mAb
BS48154-01	EGF Recombinant Rabbit mAb
BS7426-01	EGF polyclonal antibody
BS90448	EGF polyclonal antibody
BS72033-01	EGF polyclonal antibody
BS75087	EGF polyclonal antibody

Alternative Products

Catalog	Name
BK0218	RecombinantHB-EGF,Human
Z05234-500	EGF, Human
MBS692154-01	Human EGF
MDP0849	EGF (Human)
OM300945-01	EGF Human
Z102155	Recombinant Human HB-EGF (Heparin Binding EGF)
PT-A01525-01	EGF Long Human
P5552-1mg	Recombinant Human EGF
PR27007-100	EGF Human Protein

RecombinantHB-EGF, Human

Related Products

Alternative Products

Popular Products