Products for Research Use Only
RegisterLogin

Apolipoprotein E/APOE, Rabbit (His-SUMO)

CAT: 0804-HY-P72083Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72083Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
Product Name Alternative
Apolipoprotein E/APOE Protein, Rabbit (His-SUMO), Rabbit, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apolipoprotein-e-apoe-protein-rabbit-his-sumo.html
Smiles
TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Molecular Formula
100009337 (Gene_ID) P18287 (T20-Q311) (Accession)
Molecular Weight
Approximately 53.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P701096-01Apolipoprotein E/APOE, Rat (His)
HY-P72084-01Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)
HY-P7532-01Apolipoprotein E/APOE, Mouse (HEK293, His)
HY-P78239-01Apolipoprotein E/APOE, Mouse (HEK293, Fc)
HY-P700853-01Apolipoprotein E/APOE4, Human (HEK293, His)
HY-P7531-01Apolipoprotein E/APOE3, Human (HEK293, His)
HY-P78062-01Apolipoprotein E/APOE3, Human (Biotinylated, HEK293, His)
HY-P705453Apolipoprotein E/APOE4, Human (C130R, HEK293, His)
HY-P71567-01OGDC-E, Mouse (His-SUMO)
HY-P71514-01RuvC, E.coli (His-SUMO)

Alternative Products

CatalogName
TMPH-03199-01Apolipoprotein E/APOE Protein, Rabbit, Recombinant (His & Myc & SUMO)
abx652556-01Rabbit Apolipoprotein E (APOE) Protein
KT-7468Rabbit Apolipoprotein E (APOE) ELISA
E2381129Apolipoprotein E/ApoE Rabbit pAb
MBS957459-01Recombinant Rabbit Apolipoprotein E (APOE)
MBS2707489-01Rabbit Apolipoprotein E (APOE) ELISA Kit
NBP1-31123SSRabbit Polyclonal Apolipoprotein E/ApoE Antibody
MBS7053696-01Recombinant Rabbit Apolipoprotein E (APOE), partial
B6113Apolipoprotein E (APOE) Rabbit ELISA Kit
TA302010Apolipoprotein E (APOE) Rabbit Polyclonal Antibody

Popular Products