Products for Research Use Only
RegisterLogin

CD1D, Human (His-SUMO)

CAT: 0804-HY-P74327ASize: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P74327ASize:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..
Product Name Alternative
CD1D Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/cd1d-protein-human-his-sumo.html
Smiles
EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
Molecular Formula
912 (Gene_ID) P15813 (E20-S301) (Accession)
Molecular Weight
Approximately 47.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P75437-01CD1D, Mouse (HEK293, His)
HY-P74326-01CD1D-B2M Heterodimer, Human (HEK293, His)
HY-P704529CDK5, Human (His-SUMO)
HY-P700536-01CXCR2, Human (His-SUMO)
HY-P70700-01TMEM173, Human (Sumo-His)
HY-P72116-01CAPZA2, Human (His-SUMO)
HY-P700595PRPS1, Human (His-SUMO)
HY-P71599DENND1A, Human (His-SUMO)
HY-P73700PRAC, Human (His-SUMO)
HY-P71577EIF3M, Human (His-SUMO)

Alternative Products

CatalogName
372657-01CD1D, Recombinant, Human, aa20-301, His-SUMO-Tag (Antigen-presenting Glycoprotein CD1D)
E24PHA286Human CD1d, His Tag
KMPH2495Human CD1D Protein, His Tag
ARO-P14003-01Recombinant Human CD1d, N-His
P501663CD1d Protein (N-His, Human)
P501666CD1d Protein (C-His, Human)
E51P90175CD1D protein, Human, Recombinant (His)
QP5784-ec-500ugRecombinant Human Antigen-presenting glycoprotein CD1d Protein, His-SUMO, E.coli-500ug
QP5784-ec-50ugRecombinant Human Antigen-presenting glycoprotein CD1d Protein, His-SUMO, E.coli-50ug
QP5784-ec-1mgRecombinant Human Antigen-presenting glycoprotein CD1d Protein, His-SUMO, E.coli-1mg

Popular Products