NRAS, Human (His, solution)

• Description:

  NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

• Product Name Alternative:

  NRAS Protein, Human (His, solution), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/nras-protein-human-his.html

• Purity:

  95.20

• Smiles:

  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

• Molecular Formula:

  4893 (Gene_ID) P01111 (M1-C186) (Accession)

• Molecular Weight:

  Approximately 24 kDa

• Shipping Conditions:

  Dry ice

• Storage Conditions:

  Stored at -80°C for 1 year

• Scientific Category:

  Recombinant Proteins