DUSP14, Human (His)

• Description :

  DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

• Product Name Alternative :

  DUSP14 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/dusp14-protein-human-his-mbp.html

• Purity :

  96.0

• Smiles :

  MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

• Molecular Formula :

  11072 (Gene_ID) O95147 (M1-H191) (Accession)

• Molecular Weight :

  Approximately 21-23 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins