WBP2, Human (His)

CAT: 0804-HY-P71431Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P71431Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Name Alternative

WBP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wbp2-protein-human-his.html

Smiles

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Molecular Formula

23558 (Gene_ID) Q969T9-1 (M1-A100) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-RS15750	WBP2 Human Pre-designed siRNA Set A
HY-RS20838	Wbp2 Mouse Pre-designed siRNA Set A
HY-RS27352	Wbp2 Rat Pre-designed siRNA Set A
HY-P71430	WBP1, Human (His)
HY-P76688	UBE2F, Human (His)
HY-P71535-01	TEAD4, Human (His)
HY-P76754-01	CABP5, Human (His)
HY-P76504-01	NAPG, Human (His)
HY-P75930-01	MTSS1, Human (His)
HY-P75991-01	PSME2, Human (His)

Catalog	Name
TMPJ-01260-01	WBP2 Protein, Human, Recombinant (His)
P519260	WBP2 Protein (N-His, Human)
YHK54001	Recombinant Human WBP2 Protein, N-His
PKSH033227-01	Recombinant Human WBP2 Protein (His Tag)
AR50528PU-S	WBP2 (1-261, His-tag) Human Protein
PV046028	WBP2 Protein Vector (Human) (pPM-C-His)
PV046025	WBP2 Protein Vector (Human) (pPB-C-His)
PV046026	WBP2 Protein Vector (Human) (pPB-N-His)
QP13954-1mg	Recombinant Human WBP2 Protein, His, E.coli-1mg
E53A04494	WBP2, 1-261aa, Human, His tag, E.coli