LIF, Human

• Description:

  LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

• Product Name Alternative:

  LIF Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Applications:

  Neuroscience-Neuromodulation

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/lif-protein-human.html

• Purity:

  98.0

• Smiles:

  SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

• Molecular Formula:

  3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

• Molecular Weight:

  Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76 (1) :50-6.|[2]Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18 (14) :5456-62.|[3]Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10 (10) :2839-48.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins