LIF, Mouse (HEK293)

• Description :

  LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

• Product Name Alternative :

  LIF Protein, Mouse (HEK293), Mouse, HEK293

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/lif-protein-mouse-hek293.html

• Purity :

  96.20

• Smiles :

  SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

• Molecular Formula :

  16878 (Gene_ID) P09056/NP_032527.1 (S24-F203) (Accession)

• Molecular Weight :

  Approximately 35.6 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins