LIF, Human (HEK293)

• Description :

  LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

• Product Name Alternative :

  LIF Protein, Human (HEK293), Human, HEK293

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

• Purity :

  97.70

• Smiles :

  SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

• Molecular Formula :

  3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

• Molecular Weight :

  Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins