DUTPase/DUT, Human

• Description :

  Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  DUTPase/DUT Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/dutpase-dut-protein-human.html

• Purity :

  95.00

• Smiles :

  MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

• Molecular Formula :

  1854 (Gene_ID) P33316-2 (M1-N164) (Accession)

• Molecular Weight :

  Approximately 18.0 kDa

• Shipping Conditions :

  Dry ice

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins