MD-2/LY96, Human (142a.a, His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


MD-2/LY96, Human (142a.a, His)
Description:
MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.Product Name Alternative:
MD-2/LY96 Protein, Human (142a.a, His), Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/md2-protein-human-his-solutin.htmlPurity:
95.0Smiles:
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSNMolecular Formula:
23643 (Gene_ID) Q9Y6Y9-1 (Q19-N160) (Accession)Molecular Weight:
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
