HPGDS, Human

• Description :

  HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.

• Product Name Alternative :

  HPGDS Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/hpgds-protein-human.html

• Purity :

  95.00

• Smiles :

  MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

• Molecular Formula :

  27306 (Gene_ID) O60760 (M1-L199) (Accession)

• Molecular Weight :

  Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins