Recombinant Human Complement decay-accelerating factor (CD55), partial

• Product Name Alternative :

  Complement decay-accelerating factor (CD antigen CD55)

• Abbreviation :

  Recombinant Human CD55 protein, partial

• Gene Name :

  CD55

• UniProt :

  P08174

• Expression Region :

  35-126aa

• Organism :

  Homo sapiens (Human)

• Target Sequence :

  DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE

• Tag :

  N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

• Type :

  In Stock Protein

• Source :

  E.coli

• Field of Research :

  Immunology

• Relevance :

  This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade (PubMed:7525274) . Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage (PubMed:28657829) .; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable) .; (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.

• Endotoxin :

  Not test

• Purity :

  Greater than 85% as determined by SDS-PAGE.

• Activity :

  Not Test

• Form :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight :

  45.4 kDa

• References & Citations :

  "Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features." Blomqvist S., Savolainen C., Raman L., Roivainen M., Hovi T. J. Clin. Microbiol. 40:4218-4223 (2002)

• Storage Conditions :

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length :

  Partial of Isoform 2