Recombinant Human Complement decay-accelerating factor (CD55), partialRecombinant Human Complement decay-accelerating factor (CD55), partial - High-quality laboratory reagent available from Gentaur. Catalog: 399-CSB-EP004945HU1-01.399-CSB-EP004945HU1-01399-CSB-EP004945HU1-01Business & Industrial > Science & LaboratoryRecombinant Human Complement decay-accelerating factor (CD55), partial
Gentaur
EUR12027-02-20

Recombinant Human Complement decay-accelerating factor (CD55), partial

CAT:
399-CSB-EP004945HU1-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Complement decay-accelerating factor (CD55), partial - image 1

Recombinant Human Complement decay-accelerating factor (CD55), partial

  • Product Name Alternative:

    Complement decay-accelerating factor (CD antigen CD55)
  • Abbreviation:

    Recombinant Human CD55 protein, partial
  • Gene Name:

    CD55
  • UniProt:

    P08174
  • Expression Region:

    35-126aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE
  • Tag:

    N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade (PubMed:7525274) . Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage (PubMed:28657829) .; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable) .; (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    45.4 kDa
  • References & Citations:

    "Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features." Blomqvist S., Savolainen C., Raman L., Roivainen M., Hovi T. J. Clin. Microbiol. 40:4218-4223 (2002)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial of Isoform 2